PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000240855
Common NameNAC15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 547aa    MW: 60827.1 Da    PI: 4.3813
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000240855genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.58e-4771342129
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                    +pGfrF+Ptd el++++Lk+k+ gk+l++ +vi+evd+yk++PwdLp k   ++++ +wyfF++r+kkya+g+r +rat  gyWk+tgkd++vl  
  MDP0000240855   7 APGFRFQPTDVELLKYFLKRKLIGKRLHV-KVISEVDVYKYDPWDLPdKsGWDSGDLKWYFFCPREKKYARGNRIQRATVGGYWKTTGKDRSVLX- 100
                    59***************************.99**************95335556777**************************************. PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                    +g++vg  ktL+f++grap+g +tdWvmheyrle
  MDP0000240855 101 SGAVVGWIKTLIFHTGRAPHGDRTDWVMHEYRLE 134
                    999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-554156IPR003441NAC domain
PROSITE profilePS5100553.0676156IPR003441NAC domain
PfamPF023657.6E-238133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MGKMFKAPGF RFQPTDVELL KYFLKRKLIG KRLHVKVISE VDVYKYDPWD LPDKSGWDSG  60
DLKWYFFCPR EKKYARGNRI QRATVGGYWK TTGKDRSVLX SGAVVGWIKT LIFHTGRAPH  120
GDRTDWVMHE YRLEDQGLXD RGVPLDSYVL CMIFQKEGLG PRNGAQYGKP FNEEDWSDDE  180
VAEGFEDANT PGPYLGLLCN ENSPIANNTH SLEDIGIGPP SGSCISDILP QSCKVLQPVS  240
SNYVTMEKSH ASHGDDILPT FDYSREENTF FMSENGKSMA QIHSEAVPNA SMPKLNHVLP  300
SNHNGFASTS AFFSERIGIG PSESFMSDIA PPHSNALQPE TGNYVTTEKA HMSDGDILSM  360
FDYFPEESTL YMYGNDKIET GGCLETVLNA NIPEPGQVLA SNYNTFISTN TQSSEVIGIG  420
PSFQSCGIDV LPPSWEVLQP VSCNYVAMEK TPASNGDDIL PMLDCFAEES TFLMNENHNN  480
EELDNFIDFG NNAQAIPHLN TSNMYENLED LGNNLDGYNF SGVHDDSANH FLELGDLDQP  540
MNGDNSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-46815717169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.27700.0cell culture| fruit| leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280771.10.0uncharacterized LOC103400464
TrEMBLD9ZJ930.0D9ZJ93_MALDO; NAC domain class transcription factor
STRINGBra009379.1-P2e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.13e-90NAC domain containing protein 103